PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0110s00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 483aa    MW: 54487.3 Da    PI: 9.9151
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0110s00030.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.52.5e-32340395156
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       k+r++W+peLH+rFv+a+++LGGs+ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Vang0110s00030.1 340 KQRRCWSPELHRRFVNALQKLGGSQAATPKQIRELMQVDGLTNDEVKSHLQKYRLH 395
                       79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.27E-18337398IPR009057Homeodomain-like
PROSITE profilePS5129414.461337397IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-29338398IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-27340395IPR006447Myb domain, plants
PfamPF002495.2E-8342393IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
LLFSNSSSFS YFLFPQNLRV LKFAYIHFPY FLFIIRNLTL FLSHSYLFLH PFPLPSPRSL  60
FLHFFFSCKQ NLNLKRKHDP MGSVLPELSL DLRPSFVPKT ITDFLRHLSS ATDRLATLHD  120
FLSRLEDELR KIHAFKRELP LSMLLLNDAI SLLKTESQKC RLRDSSPVLE EFIPLKKERD  180
RNEGNNYNDN DMDNECRDKK NWLSSVQLWN NSTTNNYASD RKHQQLHTLE NKKIEEGQSV  240
GEDPFQSCSN RNGGRRAFMP FSRYSSSSSS VPVATAGLAA ATKEEKEESV MNRLSLQTPS  300
VKEGCGSRGS RSSSSRAVSS SPPTVHPSLR ASSLQQTARK QRRCWSPELH RRFVNALQKL  360
GGSQAATPKQ IRELMQVDGL TNDEVKSHLQ KYRLHTRRVP AGSGNQPVVV LGGLWMSQDQ  420
YNDSSKVSSS GSGSPQSPLH LTTGSRGGTS PTEGDSMEDD EDARSESYSW KSHMQKPGKV  480
DV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014510738.10.0PREDICTED: uncharacterized protein LOC106769578
TrEMBLA0A0L9TP830.0A0A0L9TP83_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R3I40.0A0A0S3R3I4_PHAAN; Uncharacterized protein
STRINGGLYMA07G33130.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.13e-54G2-like family protein